PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00021683-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family MYB
Protein Properties Length: 182aa    MW: 21293.2 Da    PI: 10.6453
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00021683-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.1e-181863147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           rg W + Ede+l ++v ++G+ +W++Ia++++ gR++k+c++rw++ 
  SMil_00021683-RA_Salv 18 RGHWRPAEDEKLRQLVDKYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 63
                           899*****************************.***********996 PP

2Myb_DNA-binding58.91.1e-1870113146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            r ++++eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ 
  SMil_00021683-RA_Salv  70 RRPFSEEEEERLLAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 113
                            679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.8721364IPR017930Myb domain
SMARTSM007171.8E-141766IPR001005SANT/Myb domain
SuperFamilySSF466898.99E-3017111IPR009057Homeodomain-like
PfamPF002491.2E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-271971IPR009057Homeodomain-like
CDDcd001674.74E-132162No hitNo description
PROSITE profilePS5129427.38865119IPR017930Myb domain
SMARTSM007171.2E-1569117IPR001005SANT/Myb domain
PfamPF002491.4E-1570112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2172118IPR009057Homeodomain-like
CDDcd001676.02E-781112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MDESRCRGSN DDPRTCPRGH WRPAEDEKLR QLVDKYGPQN WNSIAEKLQG RSGKSCRLRW  60
FNQLDPRINR RPFSEEEEER LLAAHRIHGN KWALISRLFP GRTDNAVKNH WHVIMARKQR  120
EKSKLCGKIR AHNQDLNALI MDSKSPTNYT KTRTRTRTIA EEKSMEKKDV PFIDFLGVGI  180
SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32181187107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0594590.0KF059459.1 Salvia miltiorrhiza MYB-related transcription factor (MYB105) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101908.18e-87PREDICTED: transcription factor MYB113
SwissprotQ9FDW16e-40MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A059PRX51e-107A0A059PRX5_SALMI; MYB-related transcription factor
STRINGSolyc04g064540.2.16e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-64myb domain protein 52